PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06968g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 297aa    MW: 33477.9 Da    PI: 7.8474
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06968g00020.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.1e-20131185256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ ++tk+q  +Lee F+++++++ ++++ LAk+lgL+ rqV vWFqNrRa+ k
  Niben101Scf06968g00020.1 131 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLKPRQVEVWFQNRRARTK 185
                               678899***********************************************98 PP

2HD-ZIP_I/II129.21.7e-41131220191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rl+k+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+
  Niben101Scf06968g00020.1 131 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLHKEVQ 215
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Niben101Scf06968g00020.1 216 ELR-AL 220
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-271108IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.09E-18125188IPR009057Homeodomain-like
PROSITE profilePS5007117.41127187IPR001356Homeobox domain
SMARTSM003891.4E-17129191IPR001356Homeobox domain
PfamPF000462.9E-17131185IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-18131185IPR009057Homeodomain-like
CDDcd000861.67E-16131188No hitNo description
PRINTSPR000311.3E-5158167IPR000047Helix-turn-helix motif
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5167183IPR000047Helix-turn-helix motif
PfamPF021831.7E-11187221IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.6E-27187230IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MLENQDLGLS LSLSFPENKT TNSLQLNLFS SLASSTSPSP SPFNLFQKTC WTDSFPSSDR  60
NLETCRTFLK GIDVNRIPTI TDAEEEGGVS SPNSTISSLS GNKRIEREIN CEEELDCCRG  120
ISDEEDGETC RKKLRLTKDQ SAVLEESFKE HNTLNPKQKQ ALAKRLGLKP RQVEVWFQNR  180
RARTKLKQTE VDCEFLKRCC ENLTEENRRL HKEVQELRAL KLSPQFYMQM TPPTTLTMCP  240
ACERVAGSPT PSPSGPTNVD PRAHQMGPAL QQRPMPFNLW ATSPVPHRPI SALNPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179187RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786815.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
RefseqXP_016515164.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-102HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM1AXL41e-144M1AXL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000325461e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-97homeobox protein 2